Jump to content
This site uses cookies. Continued use is acceptance of our Terms of Use and Privacy Policy. More Info... ×
  • Welcome to Celiac.com!

    You have found your celiac tribe! Join us and ask questions in our forum, share your story, and connect with others.




  • Celiac.com Sponsor (A1):



    Celiac.com Sponsor (A1-M):


  • Get Celiac.com Updates:
    Support Our Content
    eNewsletter
    Donate

Search the Community

Showing results for tags 'cooked'.

  • Search By Tags

    Type tags separated by commas.
  • Search By Author

Content Type


Celiac Disease & Gluten-Free Diet Forums

  • Diagnosis & Recovery, Related Disorders & Research
    • Coping with Celiac Disease
    • Celiac Disease Pre-Diagnosis, Testing & Symptoms
    • Post Diagnosis, Recovery & Treatment of Celiac Disease
    • Related Issues & Disorders
    • Dermatitis Herpetiformis
  • Gluten-Free Lifestyle
    • Gluten-Free Foods, Products, Shopping & Medications
    • Gluten-Free Recipes & Cooking Tips
    • Gluten-Free Restaurants
    • Traveling with Celiac Disease
    • Sports and Fitness
  • Support & Help
    • Introduce Yourself / Share Stuff
    • Parents, Friends and Loved Ones of Celiacs
    • Meet Up Room
    • Doctors
    • Publications & Publicity
  • When A Gluten-Free Diet Just Isn't Enough
    • Food Intolerance & Leaky Gut
    • Super Sensitive People
  • Forum Technical Assistance
    • Board/Forum Technical Help
  • Calendar of Events
  • DFW/Central Texas Celiacs's Events
  • DFW/Central Texas Celiacs's Groups/Organizations in the DFW area
  • Gluten-Free Crew of South Carolina's Introductions 👋
  • REDVIXENS CELIAC WARRIORS's LETS GET TO KNOW EACHOTHER !
  • REDVIXENS CELIAC WARRIORS's Navigating the Gluten-Free Social Dance
  • REDVIXENS CELIAC WARRIORS's Ice breakers -Share your most awkward gluten-free moment!
  • REDVIXENS CELIAC WARRIORS's What's your go-to gluten-free comfort food?

Celiac Disease & Gluten-Free Diet Blogs

  • kareng's Blog
  • The Autoimmune Fix
  • brhea308's Blog
  • Katie Ross' Blog
  • StephieRN's Blog
  • Chew This Up
  • nusr33n's Blog
  • BelievinMiracles' Blog
  • Kerbear's Blog
  • Dermatitis herpetiformis
  • Luna's Blog
  • amy29's Blog
  • redredwine's Blog
  • Laurie is a "sleestak"
  • Oli's Blog
  • amy29's Blog
  • GlutenFreeInSC's Blog
  • mntwins26's Blog
  • An Unmistakeable Journey
  • Svastha's Blog
  • My tummy used to hurt....
  • caseyazfox's Blog
  • Brae14 first blog
  • Sandi's Blog
  • haley12mom's Blog
  • 1desperateladysaved's Blog
  • tredart's Blog
  • Thesmophoria
  • Ali Demeritte's Blog
  • RestorationFarm's Blog
  • Help
  • nurse diesel's Blog
  • AutumnRZ's Blog
  • iang's Blog
  • Dee4275
  • BERNESES' Blog
  • Eeyore's Blog
  • rachelb86's Blog
  • Babsie
  • gf4life's Blog
  • Clossy's Blog
  • cathybee's Blog
  • What do I eat now?
  • Feelinggoodatlast's Blog
  • jenn30's Blog
  • Nancy's Celiac Adventure Blog
  • Husband_of_Celiac's Blog
  • jparyz's Blog
  • The Patient Celiac
  • Ann1231's Blog
  • poskers' Blog
  • lharris' Blog
  • Nomi's Blog
  • zipy's Blog
  • lex17's Blog
  • jennyg's Blog
  • Nomi's Blog
  • carolannjane's Blog
  • Kerry's GF Life
  • cartierclare's Blog
  • Nomi's Blog
  • gancan's Blog
  • skbird's Blog
  • freeoglutevil's Blog
  • Ronnie310's Blog
  • aaascr's Blog
  • Danesmommy's Blog
  • Colleen Markley
  • Susantg3's Blog
  • mjonesunc Dapsone Side-Effect Blog
  • cernacki's Blog
  • Colleeney's Blog
  • christicrete's Blog
  • DonnaW's Blog
  • Krystyn's Blog
  • Mosaics' Blog
  • Meemsy's Blog
  • Krystyn41's Blog
  • Trials and Tribulations
  • CeLiAc CeLeBrItY
  • Cee Cee's Blog
  • bunnyrobinson's Blog
  • ATC_BS_MS' Blog
  • learning2cope's Blog
  • Research on South African Celiac Tours
  • lindylynn's Blog
  • Celiaction's Blog
  • shelly184's Blog
  • Melissa.77's Blog
  • Keating's Not-so-Glutenfree life
  • AmandasMommy's Blog
  • Coeliac, or just plain unlucky?
  • bandanamama's Blog
  • megirae's Blog
  • Spunky's Blog
  • debnak's Blog
  • armetta's Blog
  • Ellenor Whitty's Blog
  • Mama Me Gluten Free
  • Ohmyword's Blog
  • KayJay's Blog
  • Karrera's Blog
  • Bear with me's Blog
  • nataliecooksgf's Blog
  • Blog
  • Scott's Celiac Blog
  • fitgirlie's Blog
  • Wall3424's Blog
  • Tabz's Blog
  • marshlakemom's Blog
  • Gluten Freedom
  • Angie Baker
  • Kimberly's Blog
  • Tiffanyt's Blog
  • Techmom's Blog
  • Elizaeloise's Gluten-Free Adventures
  • marie1122's Blog
  • Jonesy's Blog
  • Julie anne's Blog
  • mitchellbarbara's Blog
  • Molly's Blog
  • javore's Blog
  • micheleg7's Blog
  • K-rizzle's Blog
  • jab1980's Blog
  • Shelby
  • Reinhard1's Blog
  • Silly Yak 08's Blog
  • kristie51270's Blog
  • NotMollyRingwald's Blog
  • Searchin for a Primary Care Dr. In Redlands That is Knowledgeable about Celiac disease
  • num1habsfan's Blog
  • Adare's Blog
  • Ms. A's Blog
  • Celiac-Positive
  • Jason's Mommy's Blog
  • HeathEdm's Blog
  • CB1039's Blog
  • Mlisa's Blog
  • Lauren Johnson's Celiac Blog
  • I love my plant Cactus <3
  • Chele's Blog
  • lexusca's Blog
  • Blues Boulevard
  • Is Heat enough??
  • corprew's Blog
  • Inspiration
  • Cindy Neshe's Blog
  • JonJonQ's Blog
  • Jema's Blog
  • What I've Learned
  • Da Rant Sheet
  • Michael Fowler's Blog
  • Living in Japan with Ceoliac Disease
  • mkmaren's Blog
  • MJ
  • kcmcc's Blog
  • x1x_Stargirl_x1x's Blog
  • AuntT's Blog
  • Joe pilk
  • melly's Blog
  • amh04's Blog
  • malfnutstudent's Blog
  • Lexi's Blog
  • vivian929's Blog
  • dazed's Blog
  • nikkilea's Blog
  • Gail Marie's Blog
  • Lov2BeMe's Blog
  • dani's Blog
  • adiftime's Blog
  • bugs' Blog
  • ltsoukalas' Blog
  • 2babyangels' Blog
  • seeshell's Blog
  • My Blog
  • snash7805's Blog
  • GlutenFreeLexi's Blog
  • drewsant's Blog
  • SadAndSick's Blog
  • HONG KONG GLUTEN, WHEAT FREE PRODUCTS
  • Guth 101's Blog
  • YoAdrianne66's Blog
  • Gail Marie's Blog
  • Healthy Food Healthy You
  • SydneyT1D - Diabetic and Celiac YouTuber!
  • GFGF's Blog
  • Paramount's Blog
  • Naezer's Blog
  • Jcoursey's Blog
  • SMAS: www.celiac.com
  • gardener1's Blog
  • Naezer's Blog
  • JordanBattenSymons' Blog
  • JillianC
  • Sugar's Blog
  • Blanche22's Blog
  • Jason's Blog
  • Gluten-Free Sisters :)
  • Eab12's Celiac Blog
  • ohiodad's Blog
  • Newly Self Diagnosed?
  • misscorpiothing's Blog
  • anshika_0204's Blog
  • Petroguy
  • abqrock's Blog
  • WhoKnew?'s Blog
  • Soap Opera Central
  • nurcan's Blog
  • Cindy's Blog
  • Daughter_of_TheLight's Blog
  • nopastanopizza's Blog
  • w8in4dave's Blog
  • Mr J's Blog
  • Rachel Keating's Blog
  • paige_ann246's Blog
  • krisb's Blog
  • deetee's Blog
  • CAC's Blog
  • EmilyLinn7's Blog
  • Teri Kiefer's Blog
  • happyasabeewithceliac's Blog
  • quietmorning01's Blog
  • jaimekochan's Blog
  • Cheryl
  • Seosamh's Blog
  • donna mae's Blog
  • Colleen's blog
  • DawnJ's Blog
  • Gluten Challenge
  • twins2's Blog
  • just trying to feel better's Blog
  • Celiac Teen
  • MNBelle blog
  • Gabe351's Blog
  • moosemalibu's Blog
  • Coeliac Disease or Coeliac Sprue or Non Tropical Sprue
  • karalto's Blog
  • deacon11's Blog
  • Nyxie's Blog
  • Swpocket's Blog
  • threeringfilly's Blog
  • Madison Papers: Living Gluten-Free in a Gluten-Full World
  • babinsky's Blog
  • prettycat's Blog
  • Celiac Diagnosis at Age 24 months in 1939
  • Sandy R's Blog
  • mary m's Blog
  • Jkrupp's Blog
  • Oreo1964's Blog
  • keyboard
  • Louisa's Blog
  • Guts & Brains
  • Gluten Free Betty
  • Jesse'sGirl's Blog
  • NewMom's Blog
  • Connie C.'s Blog
  • garden girl's Blog
  • april anne's Blog
  • 4xmom's Blog
  • benalexander60's Blog
  • missmyrtle's Blog
  • Jersey Shore wheat no more's Blog
  • swezzan's Blog
  • aheartsj's Blog
  • MeltheBrit's Blog
  • glutenfreecosmeticcounter
  • Reasons Why Tummy tuck is considered best to remove unwanted belly fat?
  • alfgarrie's Blog
  • SmidginMama's Blog
  • lws' Blog
  • KMBC2014's Blog
  • Musings and Lessons Learned
  • txwildflower65's Blog
  • Uncertain
  • jess4736's Blog
  • deedo's Blog
  • persistent~Tami's Blog
  • Posterboy's Blog
  • jferguson
  • tiffjake's Blog
  • KCG91's Blog
  • Yolo's Herbs & Other Healing Strategies
  • scrockwell's Blog
  • Sandra45's Blog
  • Theresa Marie's Blog
  • Skylark's Blog
  • JessicaB's Blog
  • Anna'sMommy's Blog
  • Skylark's Oops
  • Jehovah witnesses
  • Celiac in Seattle's Blog
  • March On
  • honeybeez's Blog
  • The Liberated Kitchen, redux
  • onceandagain's Blog
  • JoyfulM's Blog
  • keepingmybabysafe's Blog
  • To beer, with love...
  • nana b's Blog
  • kookooto's Blog
  • SunnyJ's Blog
  • Mia'smommy's Blog
  • Amanda's Blog
  • jldurrani's Blog
  • Why choosing Medical bracelets for women online is the true possible?
  • Carriefaith's Blog
  • acook's Blog
  • REAGS' Blog
  • gfreegirl0125's Blog
  • Gluten Free Recipes - Blog
  • avlocken's Blog
  • Thiamine Thiamine Thiamine
  • wilbragirl's Blog
  • Gluten and Maize-Free (gluten-free-MF)
  • Elimination Diet Challenge
  • DJ 14150
  • mnsny's Blog
  • Linda03's Blog
  • GFinDC's Blog
  • Kim UPST NY's Blog
  • cmc's Blog
  • blog comppergastta1986
  • JesikaBeth's Blog
  • Melissa
  • G-Free's Blog
  • miloandotis' Blog
  • Confessions of a Celiac
  • Know the significance of clean engine oil
  • bobhayes1's Blog
  • Robinbird's Blog
  • skurtz's Blog
  • Olivia's Blog
  • Jazzdncr222's Blog
  • Lemonade's Blog
  • k8k's Blog
  • celiaccoach&triathlete's Blog
  • Gluten Free Goodies
  • cherbourgbakes.blogspot.com
  • snow dogs' Blog
  • Rikki Tikki's Blog
  • lthurman1979's Blog
  • Sprue that :)'s Blog
  • twinkletoes' Blog
  • Ranking the best gluten free pizzas
  • Gluten Free Product
  • Wildcat Golfer's Blog
  • Becci's Blog
  • sillyker0nian's Blog
  • txplowgirl's Blog
  • Gluten Free Bread Blog
  • babygoose78's Blog
  • G-freegal12's Blog
  • kelcat's Blog
  • Heavy duty 0verhead crane
  • beckyk's Blog
  • pchick's Blog
  • NOT-IN-2gluten's Blog
  • PeachPie's Blog
  • Johny
  • Breezy32600's Blog
  • Edgymama's Gluten Free Journey
  • Geoff
  • audra's Blog
  • mfrklr's Blog
  • 2 chicks
  • I Need Help With Bread
  • the strong one has returned!
  • sabrina_B_Celiac's Blog
  • Gluten Free Pioneer's Blog
  • Theanine.
  • The Search of Hay
  • Vanessa
  • racecar16's Blog
  • JCH13's Blog
  • b&kmom's Blog
  • Gluten Free Foodies
  • NanaRobin's Blog
  • mdrumr8030's Blog
  • Sharon LaCouture's Blog
  • Zinc, Magnesium, and Selenium
  • sao155's Blog
  • Tabasco's Blog
  • Amanda Smith
  • mmc's Blog
  • xphile1121's Blog
  • golden exch
  • kerrih's Blog
  • jleb's Blog
  • RUGR8FUL's Blog
  • Brynja's Grain Free Kitchen
  • schneides123's Blog
  • Greenville, SC Gluten-Free Blog
  • ramiaha's Blog
  • Kathy P's Blogs
  • rock on!'s Blog
  • Carri Ninja's Blog
  • jerseygirl221's Blog
  • Pkhaselton's Blog
  • Hyperceliac Blog
  • abbiekir's Blog
  • Lasister's Thoughts
  • bashalove's Blog
  • Steph1's Blog
  • Etboces
  • Rantings of Tiffany
  • GlutenWrangler's Blog
  • kalie's Blog
  • Mommy Of A Gluten Free Child
  • ready2go's Blog
  • Maureen
  • Floridian's Blog
  • Bobbie41972's Blog
  • Everyday Victories
  • Intolerance issue? Helpppp!
  • Feisty
  • In the Beginning...
  • Cheri46's Blog
  • Acne after going gluten free
  • sissSTL's Blog
  • Elizabeth19's Blog
  • LindseyR's Blog
  • sue wiesbrook's Blog
  • I'm Hungry's Blog
  • badcasper's Blog
  • M L Graham's Blog
  • Wolicki's Blog
  • katiesalmons' Blog
  • CBC and celiac
  • Kaycee's Blog
  • wheatisbad's Blog
  • beamishmom's Blog
  • Celiac Ninja's Blog
  • scarlett54's Blog
  • GloriaZ's Blog
  • Holly F's Blog
  • Jackie's Blog
  • lbradley's Blog
  • TheSandWitch's Blog
  • Ginger Sturm's Blog
  • The Struggle is Real
  • whataboutmary's Blog
  • JABBER's Blog
  • morningstar38's Blog
  • Musings of a Celiac
  • Celiacchef's Blog
  • healthygirl's Blog
  • allybaby's Blog
  • MGrinter's Blog
  • LookingforAnswers15's Blog
  • Lis
  • Alilbratty's Blog
  • 3sisters' Blog
  • MGrinter's Blog
  • Amanda
  • felise's Blog
  • rochesterlynn's Blog
  • mle_ii's Blog
  • GlamourGetaways' Blog
  • greendog's Blog
  • Tabz's Blog
  • Smiller's Blog
  • my vent
  • newby to celiac?'s Blog
  • siren's Blog
  • myraljo's Blog
  • Relieved and confused
  • carb bingeing
  • scottish's Blog
  • maggiemay832's Blog
  • Cristina Barbara
  • ~~~AnnaBelle~~~'s Blog
  • nikky's Blog
  • Suzy-Q's Blog
  • mfarrell's Blog
  • Kat-Kat's Blog
  • Kelcie's Blog
  • cyoshimit's Blog
  • pasqualeb's Blog
  • My girlfriend has celiacs and she refuses to see a doctor
  • Ki-Ki29's Blog
  • mailmanrol's Blog
  • Sal Gal
  • WildBillCODY's Blog
  • Ann Messenger
  • aprilz's Blog
  • the gluten-free guy
  • gluten-free-wifey's Blog
  • Lynda MEADOWS's Blog
  • mellajane's Blog
  • Jaded's Celiac adventures in a non-celiac world.
  • booboobelly18's Blog
  • Dope show
  • Classic Celiac Blog
  • Keishalei's Blog
  • Bada
  • Sherry's blurbs
  • addict697's Blog
  • MIchael530btr's Blog
  • Shawn C
  • antono's Blog
  • Undiagnosed
  • little_d's Blog
  • Gluten, dairy, pineapple
  • The Fat (Celiac) Lady Sings
  • Periomike
  • Sue Mc's Blog
  • BloatusMaximus' Blog
  • It's just one cookie!
  • Kimmy
  • jacobsmom44's Blog
  • mjhere's Blog
  • tlipasek's Blog
  • You're Prescribing Me WHAT!?!
  • Kimmy
  • nybbles's Blog
  • Karla T.'s Blog
  • Young and dealing with celiacs
  • Celiac.com Podcast Edition
  • LCcrisp's Blog
  • ghfphd's allergy blog
  • https://www.bendglutenfree.com/
  • Costume's and GF Life
  • mjhere69's Blog
  • dedeadge's Blog
  • CeliacChoplin
  • Ravenworks' Blog
  • ahubbard83's Blog
  • celiac<3'sme!'s Blog
  • William Parsons
  • Gluten Free Breeze (formerly Brendygirl) Blog
  • Ivanna44's Blog
  • Daily Life and Compromising
  • Vonnie Mostat
  • Aly'smom's Blog
  • ar8's Blog
  • farid's Blog
  • Sandra Lee's Blog
  • Demertitis hepaformis no Celac
  • Vonnie Mostat, R.N.
  • beetle's Blog
  • Sandra Lee's Blog
  • carlyng4's Blog
  • totalallergyman's Blog
  • Kim
  • Vhips
  • twinsmom's Blog
  • Newbyliz's Blog
  • collgwg's Blog
  • Living in the Gluten Free World
  • lisajs38's Blog
  • Mary07's Blog
  • Treg immune celsl, short chain fatty acids, gut bacteria etc.
  • questions
  • A Blog by Yvonne (Vonnie) Mostat, RN
  • ROBIN
  • covsooze's Blog
  • HeartMagic's Blog
  • electromobileplace's Blog
  • Adventures of a Gluten Free Mom
  • Fiona S
  • bluff wallace's Blog
  • sweetbroadway's Blog
  • happybingf's Blog
  • Carla
  • jaru24's Blog
  • AngelaMH's Blog
  • collgwg's Blog
  • blueangel68's Blog
  • SimplyGF Blog
  • Jim L Christie
  • Debbie65's Blog
  • Alcohol, jaundice, and celiac
  • kmh6leh's Blog
  • Gluten Free Mastery
  • james
  • danandbetty1's Blog
  • Feline's Blog
  • Linda Atkinson
  • Auntie Lur: The Blog of a Young Girl
  • KathyNapoleone's Blog
  • Gluten Free and Specialty Diet Recipes
  • Why are people ignoring Celiac Disease, and not understanding how serious it actually is?
  • miasuziegirl's Blog
  • KikiUSA's Blog
  • Amyy's Blog
  • Pete Dixon
  • abigail's Blog
  • CHA's Blog
  • Eczema or Celiac Mom?'s Blog
  • Thoughts
  • International Conference on Gastroenterology
  • Deedle's Blog
  • krackers' Blog
  • cliniclfortin's Blog
  • Mike Menkes' Blog
  • Juanita's Blog
  • BARB OTTUM
  • holman's Blog
  • It's EVERYWHERE!
  • life's Blog
  • writer ann's Blog
  • Ally7's Blog
  • Gluten Busters: Gluten-Free Product Alerts by Celiac.com
  • K Espinoza
  • klc's Blog
  • Pizza&beer's Blog
  • CDiseaseMom's Blog
  • sidinator's Blog
  • Dr Rodney Ford's Blog
  • How and where is it safe to buy cryptocurrency?
  • lucedith's Blog
  • Random Thoughts
  • Kate
  • twin#1's Blog
  • myadrienne's Blog
  • Nampa-Boise Idaho
  • Ursa Major's Blog
  • bakingbarb's Blog
  • Does Celiac Cause Sensitivites To Rx's?
  • delana6303's Blog
  • psychologygrl25's Blog
  • Alcohol and Celiac Disease
  • How do we get it???
  • cooliactic_BOOM's Blog
  • GREAT GF eating in Toronto
  • Gluten-free Food Recommendations!
  • YAY! READ THIS!!
  • BROW-FREE DIET BLOG
  • carib168's Blog
  • A Healing Kitchen
  • Shawn s
  • AZ Gal's Blog
  • mom1's Blog
  • The Beginning - The Diagnosis
  • PeweeValleyKY's Blog
  • solange's Blog
  • Cate K's Blog
  • Layered Vegetable Baked Pasta (gluten-free Vegetarian Lasagna)
  • Gluten Free Teen by Ava
  • mtdawber's Blog
  • sweeet_pea's Blog
  • DCE's Blog
  • Infertility and Celiac Disease
  • What to do in the Mekong Delta in 1 Day?
  • glutenfreenew's Blog
  • Living in the Garden of Eden
  • toddzgrrl02's Blog
  • redface's Blog
  • Gluten Free High Protein
  • Ari
  • Great Harvest Chattanooga's Blog
  • CeliBelli's Blog
  • Aboluk's Blog
  • redface's Blog
  • Being in Control of Your Gluten-Free Diet on a Cruise Ship
  • jayshunee's Blog
  • lilactorgirl's Blog
  • Yummy or Yucky Gluten-Free Foods
  • Electra's Blog
  • Cocerned husband's Blog
  • lilactorgirl's Blog
  • A Little History - My Celiac Disease Diagnosis
  • How to line my stomach
  • sewfunky's Blog
  • Oscar's Blog
  • Chey's Blog
  • The Fun of Gluten-free Breastfeeding
  • Dawnie's Blog
  • Sneaky gluten free goodness!
  • Chicago cubs shirts- A perfect way of showing love towards the baseball team!
  • Granny Garbonzo's Blog
  • GFzinks09's Blog
  • How do I get the Celiac.com podcast on my mp3 player?
  • quantumsugar's Blog
  • Littlebit's Blog
  • Kimberly's Blog
  • Dayz's Blog
  • Swimming Breadcrumbs and Other Issues
  • Helen Burdass
  • celiacsupportnancy's Blog
  • Life of an Aggie Celiac
  • kyleandjra.jacobson's Blog
  • Hey! I'm Not "Allergic" to Wheat!
  • FoOdFaNaTic's Blog
  • Wendy Cohan, RN's Gluten-Free and Dairy-Free Cooking Classes
  • Lora Derry
  • Dr. Joel Goldman's Blog
  • The Ultimate Irony
  • Lora Derry
  • ACK514's Blog
  • katinagj's Blog
  • What Goes On, Goes In (Gluten in Skin Care Products)
  • What’s new in hydraulic fittings?
  • cannona3's Blog
  • citykatmm's Blog
  • Adventures in Gluten-Free Toddling
  • tahenderson67's Blog
  • The Dinner Party Drama—Two Guidelines to Assure a Pleasant Gluten-Free Experience
  • What’s new in hydraulic fittings?
  • sparkybear's Blog
  • justbikeit77's Blog
  • To "App" or Not to "App": The Use of Gluten Free Product List Computer Applications
  • Onangwatgo
  • Raine's Blog
  • lalla's Blog
  • To die for Cookie Crumb Gluten-Free Pie Crust
  • DeeTee33's Blog
  • http://glutenfreegroove.com/blog/
  • David2055's Blog
  • Gluten-Free at the Fancy Food Show in San Francisco
  • Kup wysokiej jakości paszporty, prawa jazdy, dowody osobiste
  • Janie's Blog
  • Managing Hives & Gluten Allergies
  • Bogaert's Blog
  • Janie's Blog
  • RaeD's Blog
  • Dizzying Disclaimers!
  • Dream Catcher's Blog
  • PinkZebra's Blog
  • Hibachi Food and Hidden Gluten Hazards (How to Celebrate Gluten-Free)
  • jktenner's Blog
  • OhSoTired's Blog
  • PinkZebra's Blog
  • gluten-free Lover's Blog
  • Gluen Free Health Australia
  • Melissamb21's Blog
  • Andy C's Blog
  • halabackgirl9129's Blog
  • Liam Edwards' Blog
  • Celiac Disease in Africa?
  • Suz's Blog
  • Gluten-Free Fast Food
  • Eldene Goosen
  • mis_chiff's Blog
  • gatakat's Blog
  • macocha's Blog
  • Newly Diagnosed Celiacs Needed for Study in Chicago
  • Elaine Anne
  • Poor Baby's Blog
  • the loonie celiac's Blog
  • jenlex's Blog
  • Sex Drive/Testosterone can be Depleted by Certain Foods
  • Sharon
  • samantha79's Blog
  • 21 Months into the Gluten-free Diet
  • WashingtonLady's Blog-a-log
  • James S. Reid's Blog
  • Living with a Gluten-Free Husband
  • Diane King
  • runner girl's Blog
  • kp3972's Blog
  • ellie_lynn's Blog
  • trayne91's Blog
  • Gluten-free Lipstick!
  • Debado
  • Nonna2's Blog
  • Schar Chocolate Hazelnut Bar (Gluten-Free)
  • Diane
  • pnltbox27's Blog
  • Live2BWell's Blog
  • melissajohnson's Blog
  • nvsmom's Blog
  • Diagnosed with Celiac Disease and Still Sick
  • Coming out having gluten intolerance and celiac disease
  • snowcoveredheart's Blog
  • Gluten Free Nurse
  • Gluten-Free Frustration!
  • Jordan23
  • Melody A's Blog
  • novelgutfeeling's Blog
  • Trouble Eating Out Gluten-Free...Good or Bad?!
  • Joe Westerlind
  • dilsmom's Blog
  • theceliachusband's Blog
  • amanda2610's Blog
  • Pancreas and Celiac Disease Link?
  • epiphany's Blog
  • Patty55's Blog
  • The Latest Gluten-Free Food Recalls
  • kenzie's blog
  • CVRupp's Blog
  • Having a Bad Day at the Doctor's Office
  • Everlasting Hope
  • Eating Gluten-Free at a Japanese Restaurant / Hibachi Grill
  • winniepooh's Blog
  • Lpa's Blog
  • Layla's Blog
  • Some Set-backs While on the Gluten-Free Diet
  • Keeping track...
  • ChristinaEve's Blog
  • A Celiac's Journal
  • Dining out Gluten Free
  • JerryK's Blog
  • Almendra's Blog
  • The Start
  • boho*mama's Blog
  • blueb's Blog
  • Cassy's Blog
  • Meliexox's Blog
  • Andrewx12's Blog
  • Cassy's Blog
  • Mrs. Alaska has Celiac Disease & Makes Gluten-free Living her Platform
  • little_c's Blog
  • GlutenFreeRaleigh's Blog
  • My struggles with the devil (celiac disease)
  • Meat Glue Secret - Why Celiacs Need to Beware of this Possibly Non-Gluten-free Ingredient
  • Gluten Free News
  • 1desperateladysaved's Blog
  • Anquish Over Gluten Free Easter
  • ANABANANA's Blog
  • Ceoliac Disease and Bladder problems
  • Hannahbutterfly's Blog
  • Gluten-Free Labeling and the FDA: We Are Watching (and so is Monty)
  • Jen's Thoughts
  • Be Careful!
  • Sunshine*'s Blog
  • num1habsfan's Blog
  • sophie5's Blog
  • How it all started...AKA...In the beginning
  • Blackwolf's Blog
  • charles76's Blog
  • Where do you want to eat Rich?
  • Joel_in_Phoenix's Blog
  • Evey's Blog
  • MissCandiquik's Blog
  • Beachmama's Blog
  • Frito-Lay to Begin Labeling Gluten-Free Products
  • megg811's Blog
  • The Gluten Free Fad
  • You Are Not A Celiac
  • mayleigh's Blog
  • lwb's Blog
  • Thank You for the Opportunity to Blog about Celiac Disease
  • IM85's Blog
  • Ramblings of the Pink Zella
  • My Story (Gettng Diagnosed with Celiac Disease)
  • Relentlessly Evolving
  • Autoimmune_what?!14's Blog
  • The Story of My Diagnosis
  • Hi from NZ and a couple of queries
  • Autoimmune_what?!14's Blog
  • Why am I Still in Pain and Why Can't They Find Anything?
  • treely's Blog
  • Brutonic's Blog
  • Gluten is stupid!
  • celiacmomof4's Blog
  • Trust Your Gut!
  • To be diagnosed or not to be diagnosed? That is the question.
  • amandasmommy2's Blog
  • The Educational, Dietary and Social Experiences of College Students with Celiac Disease
  • Celiac, Leaky Gut, and Interstitial Cystitis
  • It's the Most Gluten-Free Time of the Year - Sing Along, Folks!
  • Diagnosed 6 years, Dedicated NOW
  • wheeleezdryver's Blog
  • Gluten Intolerance Doesn't Exist?!
  • wheeleezdryver's Blog
  • Lady Sky's Blog
  • Let's Talk About It
  • South Florida Celiacs's South Florida Gluten free restaurants
  • REDVIXENS CELIAC WARRIORS's Let’s extend our support and raise awareness about celiac disease,!!
  • REDVIXENS CELIAC WARRIORS's Navigating the Gluten-Free Wilderness
  • REDVIXENS CELIAC WARRIORS's Laughter is the Best Medicine: Celiac Edition 😄🍞

Categories

  • Celiac.com Sponsors
  • Celiac Disease Basics
  • Safe & Unsafe Foods & Ingredients
  • Videos
  • Product Reviews
  • Gluten-Free Recipes
    • Recipes by Continent or Country
    • Biscuits, Buns, Rolls, Scones & Waffles (Gluten-Free Recipes)
    • Dessert Recipes: Pastries, Cakes, Cookies (Gluten-Free)
    • Bread Recipes (Gluten-Free)
    • Flour Mixes (Gluten-Free)
    • Kids Recipes (Gluten-Free)
    • Snacks & Appetizers (Gluten-Free Recipes)
    • Muffins (Gluten-Free Recipes)
    • Pancakes (Gluten-Free Recipes)
    • Pizzas & Pizza Crusts (Gluten-Free Recipes)
    • Soups, Sauces, Dressings & Chowders (Gluten-Free Recipes)
    • Cooking Tips
  • Diagnosis, Testing & Treatment
  • Latest Research
  • Miscellaneous Articles
    • Additional Concerns
    • Research Projects, Fundraising, Epidemiology, Etc.
    • Conferences, Publicity, Pregnancy, Church, Bread Machines, Distillation & Beer
    • Product Labeling Regulations
    • Codex Alimentarius Wheat Starch
    • Celiac.com Podcast Edition
    • Tax Deductions
  • Journal of Gluten Sensitivity
    • Spring 2025 Issue
    • Winter 2025 Issue
    • Autumn 2024 Issue
    • Summer 2024 Issue
    • Spring 2024 Issue
    • Winter 2024 Issue
    • Autumn 2023 Issue
    • Summer 2023 Issue
    • Spring 2023 Issue
    • Winter 2023 Issue
    • Autumn 2022 Issue
    • Summer 2022 Issue
    • Spring 2022 Issue
    • Winter 2022 Issue
    • Autumn 2021 Issue
    • Summer 2021 Issue
    • Spring 2021 Issue
    • Winter 2021 Issue
    • Autumn 2020 Issue
    • Summer 2020 Issue
    • Spring 2020 Issue
    • Winter 2020 Issue
    • Autumn 2019 Issue
    • Summer 2019 Issue
    • Spring 2019 Issue
    • Winter 2019 Issue
    • Autumn 2018 Issue
    • Summer 2018 Issue
    • Spring 2018 Issue
    • Winter 2018 Issue
    • Autumn 2017 Issue
    • Summer 2017 Issue
    • Spring 2017 Issue
    • Winter 2017 Issue
    • Autumn 2016 Issue
    • Summer 2016 Issue
    • Spring 2016 Issue
    • Winter 2016 Issue
    • Autumn 2015 Issue
    • Summer 2015 Issue
    • Spring 2015 Issue
    • Winter 2015 Issue
    • Autumn 2014 Issue
    • Summer 2014 Issue
    • Spring 2014 Issue
    • Winter 2014 Issue
    • Autumn 2013 Issue
    • Summer 2013 Issue
    • Spring 2013 Issue
    • Winter 2013 Issue
    • Autumn 2012 Issue
    • Summer 2012 Issue
    • Spring 2012 Issue
    • Winter 2012 Issue
    • Autumn 2011 Issue
    • Summer 2011 Issue
    • Spring 2011 Issue
    • Winter 2011 Issue
    • Autumn 2010 Issue
    • Summer 2010 Issue
    • Spring 2010 Issue
    • Winter 2010 Issue
    • Autumn 2009 Issue
    • Summer 2009 Issue
    • Spring 2009 Issue
    • Winter 2009 Issue
    • Autumn 2008 Issue
    • Summer 2008 Issue
    • Spring 2008 Issue
    • Winter 2008 Issue
    • Autumn 2007 Issue
    • Summer 2007 Issue
    • Spring 2007 Issue
    • Winter 2007 Issue
    • Autumn 2006 Issue
    • Summer 2006 Issue
    • Spring 2006 Issue
    • Winter 2006 Issue
    • Autumn 2005 Issue
    • Summer 2005 Issue
    • Spring 2005 Issue
    • Winter 2005 Issue
    • Autumn 2004 Issue
    • Summer 2004 Issue
    • Spring 2004 Issue
    • Winter 2004 Issue
    • Autumn 2003 Issue
    • Summer 2003 Issue
    • Spring 2003 Issue
    • Winter 2003 Issue
    • Autumn 2002 Issue
    • Summer 2002 Issue
  • Related Diseases and Disorders
    • Anemia and Celiac Disease
    • Arthritis and Celiac Disease
    • Ataxia, Nerve Disease, Neuropathy, Brain Damage and Celiac Disease
    • Autism and Celiac Disease
    • Bacterial Overgrowth, Candida Albicans and Celiac Disease
    • Cancer, Lymphoma and Celiac Disease
    • Casein / Cows Milk Intolerance and Celiac Disease
    • Cognitive Impairment and Celiac Disease
    • Crohn's Disease and Celiac Disease
    • Depression and Celiac Disease
    • Dermatitis Herpetiformis: Skin Condition Associated with Celiac Disease
    • Diabetes and Celiac Disease
    • Dyspepsia, Acid Reflux and Celiac Disease
    • Epilepsy and Celiac Disease
    • Fertility, Pregnancy, Miscarriage and Celiac Disease
    • Fibromyalgia and Celiac Disease
    • Growth Hormone Deficiency and Celiac Disease
    • Heart Failure and Celiac Disease
    • Infertility, Impotency and Celiac Disease
    • Inflammatory Bowel Disease and Celiac Disease
    • Intestinal Permeability and Celiac Disease
    • Irritable Bowel Syndrome and Celiac Disease
    • Kidney Disease and Celiac Disease
    • Liver Disease and Celiac Disease
    • Migraine Headaches and Celiac Disease
    • Multiple Sclerosis and Celiac Disease
    • Obesity, Overweight & Celiac Disease
    • Osteoporosis, Osteomalacia, Bone Density and Celiac Disease
    • Psoriasis and Celiac Disease
    • Refractory Celiac Disease & Collagenous Sprue
    • Schizophrenia / Mental Problems and Celiac Disease
    • Skin Problems and Celiac Disease
    • Thyroid & Pancreatic Disorders and Celiac Disease
    • Other Diseases and Disorders Associated with Celiac Disease
  • Origins of Celiac Disease
  • Gluten-Free Grains and Flours
  • Oats: Are They Gluten-Free?
  • Frequently Asked Questions About Celiac Disease
  • Support Groups
    • Outside the USA: International Celiac Support Groups
  • Doctor Listing
  • Kids and Celiac Disease
  • Gluten-Free Travel
  • Gluten-Free Cooking
  • Gluten-Free Foods & Beverages
  • Allergy vs. Intolerance

Find results in...

Find results that contain...


Date Created

  • Start

    End


Last Updated

  • Start

    End


Filter by number of...

Joined

  • Start

    End


Group


AIM


MSN


Website URL


ICQ


Yahoo


Jabber


Skype


Interests


Location

Found 4 results

  1. Celiac.com 10/10/2017 - If you're looking for a delicious, easy to make meal that is perfect for the start of fall, this slow-cook chicken vegetable soup is just the thing. Ingredients: 2 chicken thighs, skin removed 1½ cups zucchini, halved lengthwise and sliced 1 cup yellow onion, chopped 1 cup celery, chopped 4 large cloves garlic, chopped 3 thyme sprigs, fresh 1 tablespoon chopped fresh sage 2 tablespoons vegetable oil 8 cups unsalted chicken broth 3 large carrots, diagonally sliced (2 cups) 2 large parsnips, peeled and chopped 3 cups chard, chopped ½ cup uncooked wild rice 2 teaspoons kosher salt 1 teaspoons black pepper 2 tablespoons fresh lemon juice Directions: Combine onion, celery, garlic, thyme, sage, and 1 tablespoon oil in a large slow cooker. Cover and cook on high until vegetables have slightly softened, about 10-12 minutes. Meanwhile, heat remaining 1 tablespoon oil in a large skillet over medium-high heat. Add chicken thighs; cook until well browned on all sides, about 3 minutes per side. Transfer to slow cooker; add broth, carrots, and parsnips. Reduce heat to low, cover, and cook until turkey is very tender, about 4 hours. Remove chicken thighs from slow cooker. Cut meat from bones and shred meat. Discard bones, or freeze them for stock. Return meat to slow cooker. Stir in chard, wild rice, salt, pepper, and zucchini. Cover and cook on low about 1 hour, until rice is tender. Discard thyme sprigs. Stir in lemon juice to taste. Serve.
  2. Celiac.com 05/06/2017 - Want a great gluten-free dinner idea that's tasty and ridiculously easy to make? This recipe for honey-glazed garlic chicken is just what you've been looking for. Just toss the chicken into the slow-cooker, blend the ingredients, pour over the chicken, and turn it on. Come back later, and dinner is ready to go. Serve over rice or gluten-free pasta, and add your favorite side for a delicious dinner. Ingredients: 6 skinless, boneless chicken thighs ½ cup ketchup ½ cup gluten-free soy sauce 3 tablespoons honey 3 cloves garlic, minced 1 teaspoon dried basil Directions: Arrange chicken thighs in the slow cooker. Whisk soy sauce, ketchup, honey, garlic, and basil together in a bowl. Pour over the chicken. Cook on low for 6 hours. Serve with rice, or your favorite gluten-free pasta.

  3. Celiac.com Sponsor (A8):
    Celiac.com Sponsor (A8):



    Celiac.com Sponsor (A8-M):



  4. Celiac.com 04/19/2016 - Blackened Redfish is a Cajun classic that can also be prepared quite nicely with the much easier to find Tilapia. This recipe delivers a tasty, flavorful version of blackened fish that pairs well with slow cooked red beans and rice. It's easy to make at the end of a long day. Just cook the fish and rice, and serve up the beans. Blackened Fish Ingredients: 4 tilapia fillets 1 cup long-grain white rice 2 cups fresh flat-leaf Italian parsley 1 teaspoon grated lemon zest 3 tablespoons olive oil 3 tablespoons paprika ¾ teaspoon garlic powder ¾ teaspoon dried thyme ¼ teaspoon cayenne pepper 2 tablespoons fresh lemon juice Kosher salt and pepper Lemon Wedges Directions: Cook the rice according to package directions. Meanwhile, in a food processor, pulse the parsley, lemon zest, 2 tablespoons oil, and 1/4 teaspoon each salt and pepper until finely chopped; set aside. In a small bowl, stir together the paprika, garlic powder, thyme, cayenne, ½ teaspoon salt, and ¼ teaspoon pepper. Brush the lemon juice over the fish, then coat in the spice mixture. Heat the remaining tablespoon oil in a large skillet over medium heat. Cook the fish in two batches, adding extra oil if necessary, until the fish is beginning to blacken and is opaque throughout, 2 to 3 minutes per side. Fluff the rice with a fork and fold in the parsley mixture. Serve with the fish and lemon wedges, if desired. Slow Cooked Red Beans and Rice Ingredients: 1 pound andouille sausage, sliced into rounds 1 large sweet onion, chopped 1 green bell pepper, chopped 1-2 tablespoon gluten-free red pepper sauce, to taste (optional) 8 cloves garlic, chopped 1 teaspoon ground black pepper 1 teaspoon Creole seasoning, or to taste 6 fresh basil leaves, chopped 1 ham hock 4 cups cooked rice Place the beans and water into a slow cooker. Heat a skillet over medium-high heat. Brown the sausage in the skillet; remove from the skillet with a slotted spoon and transfer to the slow cooker. Reserve drippings. Add onion, green pepper, red pepper sauce and garlic to the drippings; cook and stir until tender, about 5 minutes. Transfer everything from the skillet to the slow cooker. Season the mixture with pepper and Creole seasoning. Add the fresh basil leaves and ham hock. Cover and cook on low for about 8 hours, until beans are tender. Cook until beans reach a creamy texture.
  5. By Jessica Mahood , M.S. Bacteriology Celiac.com 09/28/2004 - A very good question: what is gliadin and why does it survive a bath in hot oil? I am a little hesitant to answer because I am not a protein chemist who specializes in such things. However, I was a bacteriologist with many years of exposure to biochemical concepts, so Im probably better equipped than most to give this a go. First of all, a protein primer: As someone mentioned, proteins are made up of building blocks. We generally call these amino acids. Sometimes amino acids are represented in the scientific literature as a single letter--you will see something like PQQLL (pay attention to this because it will come up again later). Each of those letters stands for an amino acid that is linked to the next. So, imagine the amino acids to be beads in a necklace. This configuration--the beads of amino acids connected in the necklace--is called the primary structure. Now, imagine this necklace to be twisted around itself in some fashion. This is generally known as the secondary structure of the protein and often looks like a helix. Next, take that twisted necklace and bend it around into a 3-D blob. This is known as the tertiary structure. If you were to take several different necklaces compressed into this tertiary structure and combine them, you would have a quaternary structure. So, there are four basic levels of protein structure, primary through quaternary. Of course, the actual chemistry is a bit more complicated, because many amino acids have a chemical charge to them that can influence how they respond to their neighbors, or to the outside environment. Think of a magnet--like repels like, attracts opposite. If they are attracted or repelled, its going to effect the ultimate structure of that protein. Amino acids, as molecules, are also different sizes. One amino acid may be like a small bead that fits easily between the others, while the next amino acid could be huge and practically hanging off of the necklace. Imagine this as a lump in our necklace that prohibits it from fitting neatly against another necklace in our blob. There is also the fact that not all proteins have all four of the levels of structure. Some proteins simply exist as a secondary structure or tertiary structure. So, there are many different types of protein structures in nature. Often times, these depend on the job of the protein. Hopefully I havent thoroughly confused you by now. Suffice it to say that there are many factors involved in determining the properties of a certain protein. So much so that there are actually a set series of tests that scientists use to classify proteins. It is a very complex discipline. Now, back to your original question. Proteins cannot be killed, per se, as they are not alive. HOWEVER, they can be damaged or destroyed. This is a process that is called denaturation. Denaturation can be irreversible, such as when you burn something to a crisp. Its as if you melted the strand of that necklace and all of the shapes that it made were lost. Denaturation can also be somewhat temporary. You denature your hair, to some extent, when you use a curling iron. You are slightly unraveling a higher structure of the hair protein, but it can be righted over time (unless the curling iron is too hot!). The ease with which a protein denatures depends on many things. Think back to our necklace. If we have, say, five necklaces clustered together to form a single protein, it would probably take a lot of chemical disruption to fully destroy that protein. However, if we had one tiny necklace twisted up slightly, it would be a lot less work to break it apart. There are many other factors involved in this--the size and charge of the beads, for example. Gliadin is a fragment of the protein gluten. Gliadin is NOT a single amino acid. Gliadin is simply a subset of a larger protein. Think of it as one necklace within a jumble of many. According to a Stanford research website (http://www.friedli.com/research/PhD/Predict/discuss.html), gluten has the basic structure of: MKTFLILALLAIVATTATTAVRVPVPQLQPQNPSQQQPQ EQVPLVQQQQFLGQQQPFPPQQPYPQPQPFPSQQPYLQLQ PFLQPQLPYSQPQPFRPQQPYPQPQPQYSQPQQPISQQQQ QQQQQQQQQQQQQQQIIQQILQQQLIPCMDVVLQQHNIV HGKSQVLQQSTYQLLQELCCQHLWQIPEQSQCQAIHNVVH AIILHQQQKQQQQPSSQVSFQQPLQQYPLGQGSFRPSQQ NPQAQGSVQPQQLPQFEEIRNLARK What do these letters mean? Again, they are amino acids. Each one of those letters stands for an amino acid. Its like a code. If the same letter is used, the same amino acid is in those two parts. Within that larger sequence, you see: RPQQPYPQPQPQ This smaller list of letters is the amino acid code for gliadin. So just for a start, in denaturing our gliadin, we have to destroy all of the rest of the gluten protein that is around it. The next issue is that this sequence contains the letter Q several times. This letter Q represents the amino acid glutamine. This is probably what the person meant when they said that gliadin was an amino acid. They were most likely thinking of glutamine. In any case, as far as amino acids go, glutamine is fairly large and pretty hearty. At this point in time, go to the following website: http://www.chemie.fu-berlin.de/chemistry/bio/aminoacid/glutamin_en.html Look at the picture of glutamine next to the name at the top--it looks like a couple of groups of letters connected by black lines. If you look to the far left, you see the letters H2N. A certain chemical process in the body changes that H2N into a different chemical group. This is called deamidation, and you hear about it a lot in reference to the Celiac response. It is the deamidated protein within the gliadin fragment of the gluten protein that is believed to be the big trigger for the antibody response that causes damage. What a mouthful, eh? Back to gliadin and hot oil, the original question. Okay, so now we know that proteins are pretty complicated. They can have big structures and lots of chemical interactions. Gluten is such a protein. The gliadin fragment of the gluten protein is tough to get to. You must also destroy the properties of the amino acids in the gliadin fragment to truly nullify the immune-irritating properties of gliadin to Celiacs. So, for various chemical reasons, gliadin is not easy to denature. According to that Stanford website (http://www.friedli.com/research/PhD/chapter8.html), gliadin is tough stuff. Many changes made to the protein are reversible. Researchers are still exploring the properties of gliadin and trying to find a way to use the molecules interactions to stop the Celiac response. It gives me a hope. For now, we have to resign ourselves to being suspicious of those soupy vats of oil in the back of bars and restaurants.
×
×
  • Create New...