Jump to content
  • You are not alone. Join Celiac.com for trusted gluten-free answers and forum support.



  • Celiac.com Sponsor (A1):
    Celiac.com Sponsor (A1-M):
  • Record is Archived

    This article is now archived and is closed to further replies.

    Scott Adams
    Scott Adams

    Gliadin Cooked in Hot Oil - Does it Break Down?

    Reviewed and edited by a celiac disease expert.

    By Jessica Mahood , M.S. Bacteriology

    Celiac.com Sponsor (A12):
    Celiac.com 09/28/2004 - A very good question: what is gliadin and why does it survive a bath in hot oil? I am a little hesitant to answer because I am not a protein chemist who specializes in such things. However, I was a bacteriologist with many years of exposure to biochemical concepts, so Im probably better equipped than most to give this a go.

    First of all, a protein primer: As someone mentioned, proteins are made up of building blocks. We generally call these amino acids. Sometimes amino acids are represented in the scientific literature as a single letter--you will see something like PQQLL (pay attention to this because it will come up again later). Each of those letters stands for an amino acid that is linked to the next. So, imagine the amino acids to be beads in a necklace. This configuration--the beads of amino acids connected in the necklace--is called the primary structure.

    Now, imagine this necklace to be twisted around itself in some fashion. This is generally known as the secondary structure of the protein and often looks like a helix. Next, take that twisted necklace and bend it around into a 3-D blob. This is known as the tertiary structure. If you were to take several different necklaces compressed into this tertiary structure and combine them, you would have a quaternary structure.

    So, there are four basic levels of protein structure, primary through quaternary. Of course, the actual chemistry is a bit more complicated, because many amino acids have a chemical charge to them that can influence how they respond to their neighbors, or to the outside environment. Think of a magnet--like repels like, attracts opposite. If they are attracted or repelled, its going to effect the ultimate structure of that protein. Amino acids, as molecules, are also different sizes. One amino acid may be like a small bead that fits easily between the others, while the next amino acid could be huge and practically hanging off of the necklace. Imagine this as a lump in our necklace that prohibits it from fitting neatly against another necklace in our blob.

    There is also the fact that not all proteins have all four of the levels of structure. Some proteins simply exist as a secondary structure or tertiary structure. So, there are many different types of protein structures in nature. Often times, these depend on the job of the protein.

    Hopefully I havent thoroughly confused you by now. Suffice it to say that there are many factors involved in determining the properties of a certain protein. So much so that there are actually a set series of tests that scientists use to classify proteins. It is a very complex discipline.

    Now, back to your original question. Proteins cannot be killed, per se, as they are not alive. HOWEVER, they can be damaged or destroyed. This is a process that is called denaturation. Denaturation can be irreversible, such as when you burn something to a crisp. Its as if you melted the strand of that necklace and all of the shapes that it made were lost. Denaturation can also be somewhat temporary. You denature your hair, to some extent, when you use a curling iron. You are slightly unraveling a higher structure of the hair protein, but it can be righted over time (unless the curling iron is too hot!).

    The ease with which a protein denatures depends on many things. Think back to our necklace. If we have, say, five necklaces clustered together to form a single protein, it would probably take a lot of chemical disruption to fully destroy that protein. However, if we had one tiny necklace twisted up slightly, it would be a lot less work to break it apart. There are many other factors involved in this--the size and charge of the beads, for example.

    Gliadin is a fragment of the protein gluten. Gliadin is NOT a single amino acid. Gliadin is simply a subset of a larger protein. Think of it as one necklace within a jumble of many. According to a Stanford research website (Open Original Shared Link), gluten has the basic structure of:

    MKTFLILALLAIVATTATTAVRVPVPQLQPQNPSQQQPQ
    EQVPLVQQQQFLGQQQPFPPQQPYPQPQPFPSQQPYLQLQ
    PFLQPQLPYSQPQPFRPQQPYPQPQPQYSQPQQPISQQQQ
    QQQQQQQQQQQQQQQIIQQILQQQLIPCMDVVLQQHNIV
    HGKSQVLQQSTYQLLQELCCQHLWQIPEQSQCQAIHNVVH
    AIILHQQQKQQQQPSSQVSFQQPLQQYPLGQGSFRPSQQ
    NPQAQGSVQPQQLPQFEEIRNLARK

    What do these letters mean? Again, they are amino acids. Each one of those letters stands for an amino acid. Its like a code. If the same letter is used, the same amino acid is in those two parts. Within that larger sequence, you see:

    RPQQPYPQPQPQ

    This smaller list of letters is the amino acid code for gliadin. So just for a start, in denaturing our gliadin, we have to destroy all of the rest of the gluten protein that is around it. The next issue is that this sequence contains the letter Q several times. This letter Q represents the amino acid glutamine. This is probably what the person meant when they said that gliadin was an amino acid. They were most likely thinking of glutamine. In any case, as far as amino acids go, glutamine is fairly large and pretty hearty.

    At this point in time, go to the following website: Open Original Shared Link

    Look at the picture of glutamine next to the name at the top--it looks like a couple of groups of letters connected by black lines. If you look to the far left, you see the letters H2N. A certain chemical process in the body changes that H2N into a different chemical group. This is called deamidation, and you hear about it a lot in reference to the Celiac response. It is the deamidated protein within the gliadin fragment of the gluten protein that is believed to be the big trigger for the antibody response that causes damage. What a mouthful, eh?

    Back to gliadin and hot oil, the original question. Okay, so now we know that proteins are pretty complicated. They can have big structures and lots of chemical interactions. Gluten is such a protein. The gliadin fragment of the gluten protein is tough to get to. You must also destroy the properties of the amino acids in the gliadin fragment to truly nullify the immune-irritating properties of gliadin to Celiacs.

    So, for various chemical reasons, gliadin is not easy to denature. According to that Stanford website (Open Original Shared Link), gliadin is tough stuff. Many changes made to the protein are reversible.

    Researchers are still exploring the properties of gliadin and trying to find a way to use the molecules interactions to stop the Celiac response. It gives me a hope. For now, we have to resign ourselves to being suspicious of those soupy vats of oil in the back of bars and restaurants.



    User Feedback

    Recommended Comments

    Guest dude el terrible

    Posted

    yeah!

    Link to comment
    Share on other sites
    Guest Maggie

    Posted

    Fascinating.

    Link to comment
    Share on other sites
    Guest Anna B2

    Posted

    Ya know, the longer I'm out of school, the more I appreciate these kinds of things. Much better job explaining things than my sub par high school chemistry teacher so many years ago! Thank you.

    Link to comment
    Share on other sites


    Guest
    This is now closed for further comments

  • Get Celiac.com Updates:
    Support Celiac.com:
    Donate
  • About Me

    Scott Adams
    scott_adams_dotcomer.webp

    Scott Adams was diagnosed with celiac disease in 1994. Faced with a critical lack of resources, he dedicated himself to becoming an expert on the condition to achieve his own recovery.

    In 1995, he founded Celiac.com with a clear mission: to ensure no one would have to navigate celiac disease alone. The site has since grown into one of the oldest and most trusted patient-focused resources for celiac disease and the gluten-free lifestyle.

    His work to advance awareness and support includes:

    Today, Celiac.com remains his primary focus. To ensure unbiased information, the site does not sell products and is 100% advertiser supported.


  • Celiac.com Sponsor (A17):
    Celiac.com Sponsor (A17):





    Celiac.com Sponsors (A17-M):




  • Related Articles

    Chris Bekermeier
    Gluten Warning Signs on Packaging
    Celiac.com 03/06/2013 - The hallmark of a healthy gluten-free diet is a grocery cart filled with mostly unprocessed, single-ingredient foods such as fresh produce, nuts, and meat. This is the easiest way to avoid gluten, as well as the healthiest way to eat. When you do venture into the central aisles of the grocery store, look for gluten warning signs on packaging to help you identify foods that contain gluten.
    Looking for those warning signs is more important than ever because companies are catching on to the growing popularity of gluten-free diets and many are labeling their products gluten-free. However, the U.S. Department of Agriculture (USDA) does not regulate how or when the designation of gluten-free can be added to food labels. This clouds the decision-making process for...


    Jefferson Adams
    Snack Foods Account for Majority of Gluten-free Food Sales—Is That a Problem?
    Celiac.com 10/01/2014 - News that snack foods, like cookies, crackers, salty snacks and snack bars now account for more than half of new gluten-free product sales has some leading analysts and industry representatives sounding the alarm.
    Speaking at a webinar hosted by the Institute of Food Technologists, Ardent Mills’ director of commercial insights, David Sheluga PhD, announced that the market is starting to get a bit saturated with gluten-free snack products, and that he’d like to see "a little bit more distribution of other types of product categories."
    The top-selling gluten-free categories break down as follows: Crackers ($156m), salty snacks ($125m), bread and rolls ($120m), pasta ($78m), cookies ($60m), baking mixes ($55m), RTE cereal ($49m), ancient grains ($47m)...


    Jefferson Adams
    Cheerios Are Finally Going Gluten-Free
    Celiac.com 02/25/2015 - General Mills has announced that original Cheerios, Honey Nut Cheerios and three other Cheerios varieties will undergo formula changes, including a switch to gluten-free oats, and will be released as a gluten-free cereal.
    The move by the food and cereal giant mirrors a similar recipe change that successfully boosted sales for its Chex brand, which has been gluten-free since 2010.
    The company will likely begin selling gluten-free versions in July, says Jim Murphy, president of Big G Cereals, General Mills' ready-to-eat cereal division.
    Apparently, General Mills felt that that could no longer ignore the skyrocketing sales of gluten-free foods, and the slow decline of foods that contain gluten, including breakfast cereals.
    "People are actually walking...


  • Recent Activity

    1. - trents replied to CC90's topic in Celiac Disease Pre-Diagnosis, Testing & Symptoms
      6

      Coeliac or not coeliac

    2. - knitty kitty replied to CC90's topic in Celiac Disease Pre-Diagnosis, Testing & Symptoms
      6

      Coeliac or not coeliac

    3. - knitty kitty replied to kevert93's topic in Gluten-Free Foods, Products, Shopping & Medications
      4

      Having issues with chips

    4. - CC90 replied to CC90's topic in Celiac Disease Pre-Diagnosis, Testing & Symptoms
      6

      Coeliac or not coeliac

    5. - CC90 replied to CC90's topic in Celiac Disease Pre-Diagnosis, Testing & Symptoms
      6

      Coeliac or not coeliac

  • Celiac.com Sponsor (A19):
  • Member Statistics

    • Total Members
      134,185
    • Most Online (within 30 mins)
      10,442

    Dennis E. Schertz
    Newest Member
    Dennis E. Schertz
    Joined
  • Celiac.com Sponsor (A20):
  • Celiac.com Sponsor (A22):
  • Forum Statistics

    • Total Topics
      121.7k
    • Total Posts
      1m
  • Celiac.com Sponsor (A21):
  • Popular Now

    • CC90
      6
    • kevert93
      4
    • Ginger38
      5
  • Popular Articles

    • Scott Adams
    • Scott Adams
    • Scott Adams
    • Scott Adams
    • Scott Adams
  • Upcoming Events

×
×
  • Create New...